PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011088093.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family M-type_MADS
Protein Properties Length: 274aa    MW: 30369.3 Da    PI: 9.4332
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011088093.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.91.1e-222370249
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    +ien++n qvtfskRr+g++KKA+ELS+LC+ae a+++fs+ +k + +
  XP_011088093.1 23 KIENETNLQVTFSKRRAGLFKKASELSTLCGAETALLVFSPGNKAHSF 70
                    69****************************************998877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.0631474IPR002100Transcription factor, MADS-box
SMARTSM004325.0E-331473IPR002100Transcription factor, MADS-box
CDDcd002651.08E-331588No hitNo description
SuperFamilySSF554551.83E-261586IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-191636IPR002100Transcription factor, MADS-box
PfamPF003191.1E-242370IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-193651IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-195172IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MSSSRCNNTI SKGKGRRKVN MVKIENETNL QVTFSKRRAG LFKKASELST LCGAETALLV  60
FSPGNKAHSF GHPNVEAIFK RFLDQNISPV SDAEKLLGAH HKANISQRIV ELNQIENRLE  120
LEQKCAIELD QVRKDGQSQQ WYPPTINKLD YRQLDRLKAA LLHFNQKLET KVENATRSMT  180
LCTPKATLNL GTMHKSSGRS VLGVRIDDGA GSPNAQVQAA SNTSSPNVQV CDDPVADRSN  240
AITQHELMLG KSCFTIPYSS KTNGYSVNPD EYHE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J2e-141586172Myocyte-specific enhancer factor 2A
3p57_I2e-141586172Myocyte-specific enhancer factor 2A
3p57_D2e-141586172Myocyte-specific enhancer factor 2A
3p57_C2e-141586172Myocyte-specific enhancer factor 2A
3p57_B2e-141586172Myocyte-specific enhancer factor 2A
3p57_A2e-141586172Myocyte-specific enhancer factor 2A
3kov_J2e-141586172Myocyte-specific enhancer factor 2A
3kov_I2e-141586172Myocyte-specific enhancer factor 2A
3kov_B2e-141586172Myocyte-specific enhancer factor 2A
3kov_A2e-141586172Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011088093.10.0PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLB9HEC92e-51B9HEC9_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0007s03430.17e-51(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20424223
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.11e-38AGAMOUS-like 62